Lineage for d5b27a_ (5b27 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063295Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2063298Species Human (Homo sapiens) [TaxId:9606] [50849] (19 PDB entries)
  8. 2285172Domain d5b27a_: 5b27 A: [328473]
    automated match to d3wvma_
    complexed with pg4, plm; mutant

Details for d5b27a_

PDB Entry: 5b27 (more details), 1.02 Å

PDB Description: the 1.02a structure of human fabp3 m20s mutant complexed with palmitic acid
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d5b27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b27a_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddyskslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

SCOPe Domain Coordinates for d5b27a_:

Click to download the PDB-style file with coordinates for d5b27a_.
(The format of our PDB-style files is described here.)

Timeline for d5b27a_:

  • d5b27a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18