SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h39a_ (5h39 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190102Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2190103Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2190104Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2190399Protein automated matches [190469] (14 species)
    not a true protein
  7. 2285170Species Human herpesvirus 8 [TaxId:37296] [328471] (3 PDB entries)
  8. 2285171Domain d5h39a_: 5h39 A: [328472]
    automated match to d1hvya_
    complexed with ump

Details for d5h39a_

PDB Entry: 5h39 (more details), 2 Å

PDB Description: structural analysis of kshv thymidylate synthase
PDB Compounds: (A:) orf70

SCOPe Domain Sequences for d5h39a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h39a_ d.117.1.1 (A:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirmem

SCOPe Domain Coordinates for d5h39a_:

Click to download the PDB-style file with coordinates for d5h39a_.
(The format of our PDB-style files is described here.)

Timeline for d5h39a_:

  • d5h39a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18