SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gxgb_ (5gxg B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159799Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 protein domains)
  6. 2159800Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2159849Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (19 PDB entries)
  8. 2285165Domain d5gxgb_: 5gxg B: [328466]
    Other proteins in same PDB: d5gxga_
    automated match to d4jwsc_
    complexed with dtt, fes, hem, so4

Details for d5gxgb_

PDB Entry: 5gxg (more details), 1.7 Å

PDB Description: high-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d5gxgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxgb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d5gxgb_:

Click to download the PDB-style file with coordinates for d5gxgb_.
(The format of our PDB-style files is described here.)

Timeline for d5gxgb_:

  • d5gxgb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18