Lineage for d5gxgb_ (5gxg B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159799Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 protein domains)
  6. 2159800Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2159849Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (19 PDB entries)
  8. 2285165Domain d5gxgb_: 5gxg B: [328466]
    Other proteins in same PDB: d5gxga_
    automated match to d4jwsc_
    complexed with dtt, fes, hem, so4

Details for d5gxgb_

PDB Entry: 5gxg (more details), 1.7 Å

PDB Description: high-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
PDB Compounds: (B:) putidaredoxin

SCOPe Domain Sequences for d5gxgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxgb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d5gxgb_:

Click to download the PDB-style file with coordinates for d5gxgb_.
(The format of our PDB-style files is described here.)

Timeline for d5gxgb_:

  • d5gxgb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18