Lineage for d5fx3a_ (5fx3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033932Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2033937Family b.2.3.2: Pilus subunits [49405] (10 protein domains)
  6. 2034079Protein automated matches [190569] (10 species)
    not a true protein
  7. 2034098Species Escherichia coli [TaxId:83333] [269237] (19 PDB entries)
  8. 2285157Domain d5fx3a_: 5fx3 A: [328458]
    automated match to d4csta_
    complexed with edt; mutant

Details for d5fx3a_

PDB Entry: 5fx3 (more details), 1.9 Å

PDB Description: breaking down the wall: mutation of the tyrosine gate of the universal escherichia coli fimbrial adhesin fimh
PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d5fx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fx3a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnansddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d5fx3a_:

Click to download the PDB-style file with coordinates for d5fx3a_.
(The format of our PDB-style files is described here.)

Timeline for d5fx3a_:

  • d5fx3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18