SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fyfa_ (5fyf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (59 species)
    not a true protein
  7. 2285155Species Marinobacter hydrocarbonoclasticus [TaxId:2743] [328456] (2 PDB entries)
  8. 2285156Domain d5fyfa_: 5fyf A: [328457]
    automated match to d4pwva_
    complexed with edo, hem

Details for d5fyfa_

PDB Entry: 5fyf (more details), 2.04 Å

PDB Description: structure of cyp153a from marinobacter aquaeolei
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5fyfa_:

Sequence, based on SEQRES records: (download)

>d5fyfa_ a.104.1.0 (A:) automated matches {Marinobacter hydrocarbonoclasticus [TaxId: 2743]}
mpefvetpipdvntlaledidvsnpflyrqgqwrayfkrlrdeapvhyqknspfgpfwsv
trfedilfvdkshdlfsaepqiilgdppeglsvemfiamdppkhdvqrssvqgvvapknl
kemeglirsrtgdvldslptdkpfnwvpavskeltgrmlatlldfpyeerhklvewsdrm
agaasatggefadenamfddaadmarsfsrlwrdkearraageepgfdlisllqsnketk
dlinrpmefignltllivggndttrnsmsgglvamnefprefeklkakpelipnmvseii
rwqtplaymrriakqdvelggqtikkgdrvvmwyasgnrderkfdnpdqfiidrkdarnh
msfgygvhrcmgnrlaelqlrilweeilkrfdnievveepervqsnfvrgysrlmvkltp
ns

Sequence, based on observed residues (ATOM records): (download)

>d5fyfa_ a.104.1.0 (A:) automated matches {Marinobacter hydrocarbonoclasticus [TaxId: 2743]}
mpefvetpipdvntlaledidvsnpflyrqgqwrayfkrlrdeapvhyqknspfgpfwsv
trfedilfvdkshdlfsaepqiilgdppeglvemfiamdppkhdvqrssvqgvvapknlk
emeglirsrtgdvldslptdkpfnwvpavskeltgrmlatlldfpyeerhklvewsdrma
gaasatggefadenamfddaadmarsfsrlwrdkearrageepgfdlisllqsnketkdl
inrpmefignltllivggndttrnsmsgglvamnefprefeklkakpelipnmvseiirw
qtplaymrriakqdvelggqtikkgdrvvmwyasgnrderkfdnpdqfiidrkdarnhms
fgygvhrcmgnrlaelqlrilweeilkrfdnievveepervqsnfvrgysrlmvkltpns

SCOPe Domain Coordinates for d5fyfa_:

Click to download the PDB-style file with coordinates for d5fyfa_.
(The format of our PDB-style files is described here.)

Timeline for d5fyfa_:

  • d5fyfa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18