SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fsoa_ (5fso A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189565Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2189566Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2189567Family d.113.1.1: MutT-like [55812] (17 protein domains)
  6. 2189568Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)
  7. 2189569Species Human (Homo sapiens) [TaxId:9606] [103208] (20 PDB entries)
  8. 2285154Domain d5fsoa_: 5fso A: [328455]
    automated match to d1irya_
    complexed with act, dms, s76

Details for d5fsoa_

PDB Entry: 5fso (more details), 1.67 Å

PDB Description: mth1 substrate recognition: complex with a methylaminopyrimidinedione.
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5fsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fsoa_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d5fsoa_:

Click to download the PDB-style file with coordinates for d5fsoa_.
(The format of our PDB-style files is described here.)

Timeline for d5fsoa_:

  • d5fsoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18