SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ckma3 (5ckm A:165-278)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041738Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041739Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2041740Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 protein domains)
  6. 2285141Protein automated matches [328442] (1 species)
    not a true protein
  7. 2285142Species Rattus norvegicus [TaxId:10116] [328443] (3 PDB entries)
  8. 2285152Domain d5ckma3: 5ckm A:165-278 [328453]
    Other proteins in same PDB: d5ckma2
    automated match to d1nt0a2
    complexed with ca, nag

Details for d5ckma3

PDB Entry: 5ckm (more details), 2.73 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (A:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5ckma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ckma3 b.23.1.1 (A:165-278) automated matches {Rattus norvegicus [TaxId: 10116]}
csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpy
dslkiqtdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta

SCOPe Domain Coordinates for d5ckma3:

Click to download the PDB-style file with coordinates for d5ckma3.
(The format of our PDB-style files is described here.)

Timeline for d5ckma3:

  • d5ckma3 appears in periodic updates to SCOPe 2.06 starting on 2017-01-18