SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b29a_ (5b29 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063295Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2063298Species Human (Homo sapiens) [TaxId:9606] [50849] (19 PDB entries)
  8. 2285146Domain d5b29a_: 5b29 A: [328447]
    automated match to d3wvma_
    complexed with plm; mutant

Details for d5b29a_

PDB Entry: 5b29 (more details), 1.28 Å

PDB Description: the 1.28a structure of human fabp3 f16v mutant complexed with palmitic acid at room temperature
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d5b29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b29a_ b.60.1.2 (A:) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
vdaflgtwklvdsknvddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyekea

SCOPe Domain Coordinates for d5b29a_:

Click to download the PDB-style file with coordinates for d5b29a_.
(The format of our PDB-style files is described here.)

Timeline for d5b29a_:

  • d5b29a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18