Lineage for d5cknd1 (5ckn D:1-119)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372519Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2372520Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2372521Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 protein domains)
  6. 2372555Protein automated matches [328442] (1 species)
    not a true protein
  7. 2372556Species Norway rat (Rattus norvegicus) [TaxId:10116] [328443] (3 PDB entries)
  8. 2372561Domain d5cknd1: 5ckn D:1-119 [328446]
    Other proteins in same PDB: d5ckna2, d5cknd2
    automated match to d1nt0a1
    complexed with ca

Details for d5cknd1

PDB Entry: 5ckn (more details), 2.6 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (D:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5cknd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cknd1 b.23.1.1 (D:1-119) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed

SCOPe Domain Coordinates for d5cknd1:

Click to download the PDB-style file with coordinates for d5cknd1.
(The format of our PDB-style files is described here.)

Timeline for d5cknd1: