SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5cknd1 (5ckn D:1-119)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041738Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041739Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2041740Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 protein domains)
  6. 2285141Protein automated matches [328442] (1 species)
    not a true protein
  7. 2285142Species Rattus norvegicus [TaxId:10116] [328443] (3 PDB entries)
  8. 2285145Domain d5cknd1: 5ckn D:1-119 [328446]
    Other proteins in same PDB: d5ckna2, d5cknd2
    automated match to d1nt0a1
    complexed with ca

Details for d5cknd1

PDB Entry: 5ckn (more details), 2.6 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (D:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5cknd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cknd1 b.23.1.1 (D:1-119) automated matches {Rattus norvegicus [TaxId: 10116]}
skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed

SCOPe Domain Coordinates for d5cknd1:

Click to download the PDB-style file with coordinates for d5cknd1.
(The format of our PDB-style files is described here.)

Timeline for d5cknd1:

  • d5cknd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-18