![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries) |
![]() | Domain d5tryw_: 5try W: [328441] automated match to d3krdr_ complexed with 7j0 |
PDB Entry: 5try (more details), 3 Å
SCOPe Domain Sequences for d5tryw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tryw_ d.153.1.4 (W:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
Timeline for d5tryw_: