Lineage for d5tepa2 (5tep A:430-552)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2125009Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (20 PDB entries)
  8. 2285134Domain d5tepa2: 5tep A:430-552 [328435]
    Other proteins in same PDB: d5tepa1, d5tepb_
    automated match to d1dloa1
    protein/DNA complex; complexed with 7ax

Details for d5tepa2

PDB Entry: 5tep (more details), 3.1 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7-(2- (2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)-2- naphthonitrile (jlj649), a non-nucleoside inhibitor
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5tepa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tepa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d5tepa2:

Click to download the PDB-style file with coordinates for d5tepa2.
(The format of our PDB-style files is described here.)

Timeline for d5tepa2:

  • d5tepa2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5tepa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5tepb_