SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tjrb_ (5tjr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (42 species)
    not a true protein
  7. 2284940Species Pseudomonas sp. [TaxId:1502784] [328241] (1 PDB entry)
  8. 2285121Domain d5tjrb_: 5tjr B: [328422]
    automated match to d4iyma_
    complexed with adp

Details for d5tjrb_

PDB Entry: 5tjr (more details), 2.95 Å

PDB Description: x-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. aac
PDB Compounds: (B:) Methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d5tjrb_:

Sequence, based on SEQRES records: (download)

>d5tjrb_ c.82.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 1502784]}
mtlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntp
pakraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkg
eysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpss
tlliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrg
krvqalggaknhavlmpdadldnavsalmgaaygscgercmaisvavcvgdqiadalvqk
lvpqikglkigagtscgldmgplvtgaardkvtgyidtgvaqgaelvvdgrgykvaghen
gfflggtlfdrvtpemtiykeeifgpvlcivrvnsleeamqlindheygngtciftrdge
aarlfcdeievgmvgvnvplpvpvayhsfggwkrslfgdlhaygpdgvrfytkrkaitqr
wpqrksheaaqfaf

Sequence, based on observed residues (ATOM records): (download)

>d5tjrb_ c.82.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 1502784]}
mtlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntp
pakraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkg
eysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpss
tlliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrg
krvqalggaknhavlmpdadldnavsalmgaaygcmaisvavcvgdqiadalvqklvpqi
kglgaardkvtgyidtgvaqgaelvvdgrgykfflggtlfdrvtpemtiykeeifgpvlc
ivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsf
ggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf

SCOPe Domain Coordinates for d5tjrb_:

Click to download the PDB-style file with coordinates for d5tjrb_.
(The format of our PDB-style files is described here.)

Timeline for d5tjrb_:

  • d5tjrb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-13