Lineage for d5thoz_ (5tho Z:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2284857Species Mycobacterium tuberculosis [TaxId:419947] [328158] (1 PDB entry)
  8. 2285113Domain d5thoz_: 5tho Z: [328414]
    automated match to d3krdr_
    complexed with 7c7

Details for d5thoz_

PDB Entry: 5tho (more details), 3 Å

PDB Description: crystal structure of mycobacterium tuberculosis proteasome in complex with n,c-capped dipeptide inhibitor pks2205
PDB Compounds: (Z:) Proteasome subunit beta

SCOPe Domain Sequences for d5thoz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thoz_ d.153.1.4 (Z:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d5thoz_:

Click to download the PDB-style file with coordinates for d5thoz_.
(The format of our PDB-style files is described here.)

Timeline for d5thoz_:

  • d5thoz_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-13