Lineage for d5tjrc_ (5tjr C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2284940Species Pseudomonas sp. [TaxId:1502784] [328241] (1 PDB entry)
  8. 2285110Domain d5tjrc_: 5tjr C: [328411]
    automated match to d4iyma_
    complexed with adp

Details for d5tjrc_

PDB Entry: 5tjr (more details), 2.95 Å

PDB Description: x-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. aac
PDB Compounds: (C:) Methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d5tjrc_:

Sequence, based on SEQRES records: (download)

>d5tjrc_ c.82.1.0 (C:) automated matches {Pseudomonas sp. [TaxId: 1502784]}
tlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntpp
akraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkge
ysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsst
lliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgk
rvqalggaknhavlmpdadldnavsalmgaaygscgercmaisvavcvgdqiadalvqkl
vpqikglkigagtscgldmgplvtgaardkvtgyidtgvaqgaelvvdgrgykvagheng
fflggtlfdrvtpemtiykeeifgpvlcivrvnsleeamqlindheygngtciftrdgea
arlfcdeievgmvgvnvplpvpvayhsfggwkrslfgdlhaygpdgvrfytkrkaitqrw
pqrksheaaqfaf

Sequence, based on observed residues (ATOM records): (download)

>d5tjrc_ c.82.1.0 (C:) automated matches {Pseudomonas sp. [TaxId: 1502784]}
tlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntpp
akraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkge
ysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsst
lliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgk
rvqalggaknhavlmpdadldnavsalmgaaygsercmaisvavcvgdqiadalvqklvp
qikglardkvtgyidtgvaqgaelvvdgrglggtlfdrvtpemtiykeeifgpvlcivrv
nsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvayhsfggwk
rslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf

SCOPe Domain Coordinates for d5tjrc_:

Click to download the PDB-style file with coordinates for d5tjrc_.
(The format of our PDB-style files is described here.)

Timeline for d5tjrc_:

  • d5tjrc_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-13