SCOP 1.61: Domain d19gsb2: 19gs B:2-76

Lineage for d19gsb2 (19gs B:2-76)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)

8. Domain d19gsb2: 19gs B:2-76 [32841]
   Other proteins in same PDB: d19gsa1, d19gsb1

Details for d19gsb2

PDB Entry: 19gs, 1.9 Å

PDB Description: Glutathione s-transferase p1-1

SCOP Domain Sequences for d19gsb2:

Sequence; same for both SEQRES and ATOM records:

>d19gsb2 c.47.1.5 (B:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d19gsb2:

• d19gsb2 first appeared (with stable ids) in SCOP 1.55
  
• d19gsb2 appears in SCOP 1.59
  
• d19gsb2 appears in SCOP 1.63
  
• d19gsb2 appears in the current release, SCOPe 2.08