SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u21c1 (5u21 C:1-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (119 species)
    not a true protein
  7. 2132376Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)
  8. 2285098Domain d5u21c1: 5u21 C:1-360 [328399]
    Other proteins in same PDB: d5u21a2, d5u21b2, d5u21c2, d5u21d2
    automated match to d2ogeb_
    complexed with cl, edo, na, tqp; mutant

Details for d5u21c1

PDB Entry: 5u21 (more details), 1.6 Å

PDB Description: x-ray structure of the wlarf aminotransferase from campylobacter jejuni, k184a mutant in complex with tdp-qui3n
PDB Compounds: (C:) Putative aminotransferase

SCOPe Domain Sequences for d5u21c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u21c1 c.67.1.0 (C:1-360) automated matches {Campylobacter jejuni [TaxId: 197]}
mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
ypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv

SCOPe Domain Coordinates for d5u21c1:

Click to download the PDB-style file with coordinates for d5u21c1.
(The format of our PDB-style files is described here.)

Timeline for d5u21c1:

  • d5u21c1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-13