SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5trsi_ (5trs I:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204923Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries)
  8. 2285093Domain d5trsi_: 5trs I: [328394]
    automated match to d3krdr_
    complexed with 7hz

Details for d5trsi_

PDB Entry: 5trs (more details), 3.08 Å

PDB Description: structure of mycobacterium tuberculosis proteasome in complex with n, c-capped dipeptide pks2144
PDB Compounds: (I:) Proteasome subunit beta

SCOPe Domain Sequences for d5trsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trsi_ d.153.1.4 (I:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d5trsi_:

Click to download the PDB-style file with coordinates for d5trsi_.
(The format of our PDB-style files is described here.)

Timeline for d5trsi_:

  • d5trsi_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-13