SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tq7b_ (5tq7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (808 PDB entries)
  8. 2285088Domain d5tq7b_: 5tq7 B: [328389]
    automated match to d4e4ma_
    complexed with 7gt

Details for d5tq7b_

PDB Entry: 5tq7 (more details), 2.1 Å

PDB Description: design and synthesis of a pan-jak kinase inhibitor clinical candidate (pf-06263276) suitable for inhaled and topical delivery for the treatment of inflammatory diseases of the lungs and skin
PDB Compounds: (B:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d5tq7b_:

Sequence, based on SEQRES records: (download)

>d5tq7b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfereieil
kslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqick
gmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwya
peslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqsivthliell
knngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqvrdnmag

Sequence, based on observed residues (ATOM records): (download)

>d5tq7b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfeerhlkflqqlgkgnfgsvemcrydplntgevvavkklqhhlrdfereieilkslqhd
nivkykgvcyrnlklimeylpygslrdylqkhkeridhikllqytsqickgmeylgtkry
ihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvgespifwyapeslteskfsvas
dvwsfgvvlyelftyieksksppaefmrmigsivthliellknngrlprpdgcpdeiymi
mtecwnnnvnqrpsfrdlalrvdqvrdnmag

SCOPe Domain Coordinates for d5tq7b_:

Click to download the PDB-style file with coordinates for d5tq7b_.
(The format of our PDB-style files is described here.)

Timeline for d5tq7b_:

  • d5tq7b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12