SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tryg_ (5try G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204923Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries)
  8. 2285082Domain d5tryg_: 5try G: [328383]
    automated match to d2fhh1_
    complexed with 7j0

Details for d5tryg_

PDB Entry: 5try (more details), 3 Å

PDB Description: structure of mycobacterium tuberculosis proteasome in complex with n, c-capped dipeptide pks2206
PDB Compounds: (G:) Proteasome subunit alpha

SCOPe Domain Sequences for d5tryg_:

Sequence, based on SEQRES records: (download)

>d5tryg_ d.153.1.4 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallv

Sequence, based on observed residues (ATOM records): (download)

>d5tryg_ d.153.1.4 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragsgvaslevavldanrprrafrritgsalqallv

SCOPe Domain Coordinates for d5tryg_:

Click to download the PDB-style file with coordinates for d5tryg_.
(The format of our PDB-style files is described here.)

Timeline for d5tryg_:

  • d5tryg_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-13