Lineage for d5ucvb_ (5ucv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (126 species)
    not a true protein
  7. 2285072Species Neisseria gonorrhoeae [TaxId:521006] [328373] (1 PDB entry)
  8. 2285079Domain d5ucvb_: 5ucv B: [328380]
    automated match to d1puia_
    complexed with act, cl, gdp, gol, po4

Details for d5ucvb_

PDB Entry: 5ucv (more details), 1.8 Å

PDB Description: crystal structure of a ribosome biogenesis gtp-binding protein (ysxc) from neisseria gonorrhoeae with bound gdp
PDB Compounds: (B:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d5ucvb_:

Sequence, based on SEQRES records: (download)

>d5ucvb_ c.37.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
nlfqnakffttvnhlkdlpdtpleiafvgrsnagkssaintltnhvrlayvsktpgrtqh
inffelqngnfmvdlpgygyaqvpeavrahwvnllgdylrhrkqliglvlimdarhplke
ldirmldffhttgrpvhillskadklskneqiktlsqvkkllkpysdrqnisvqlfsslk
kqgideanrtvgswfdaad

Sequence, based on observed residues (ATOM records): (download)

>d5ucvb_ c.37.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
nlfqnakffttvnhlkdlpdtpleiafvgrsnagkssaintltntqhinffelqngnfmv
dlpgygyaqvpeavrahwvnllgdylrhrkqliglvlimdarhplkeldirmldffhttg
rpvhillskadklskneqiktlsqvkkllkpysdrqnisvqlfsslkkqgideanrtvgs
wfdaad

SCOPe Domain Coordinates for d5ucvb_:

Click to download the PDB-style file with coordinates for d5ucvb_.
(The format of our PDB-style files is described here.)

Timeline for d5ucvb_:

  • d5ucvb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12