Lineage for d21gsa2 (21gs A:2-76)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699512Protein Class pi GST [81358] (4 species)
  7. 699513Species Human (Homo sapiens) [TaxId:9606] [52864] (39 PDB entries)
  8. 699545Domain d21gsa2: 21gs A:2-76 [32838]
    Other proteins in same PDB: d21gsa1, d21gsb1

Details for d21gsa2

PDB Entry: 21gs (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1 in complex with chlorambucil
PDB Compounds: (A:) glutathione s-transferase p1-1

SCOP Domain Sequences for d21gsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d21gsa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d21gsa2:

Click to download the PDB-style file with coordinates for d21gsa2.
(The format of our PDB-style files is described here.)

Timeline for d21gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d21gsa1