SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u7ba2 (5u7b A:81-208)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216874Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 2216875Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 2216881Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 2216882Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 2216883Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
    Uniprot P77072 81-212
  8. 2285078Domain d5u7ba2: 5u7b A:81-208 [328379]
    Other proteins in same PDB: d5u7ba1, d5u7bb1
    automated match to d1s6la2
    complexed with act, br, zn6

Details for d5u7ba2

PDB Entry: 5u7b (more details), 2 Å

PDB Description: crystal structure of a the tin-bound form of merb formed from diethyltin.
PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d5u7ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u7ba2 d.357.1.2 (A:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

SCOPe Domain Coordinates for d5u7ba2:

Click to download the PDB-style file with coordinates for d5u7ba2.
(The format of our PDB-style files is described here.)

Timeline for d5u7ba2:

  • d5u7ba2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5u7ba1