SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ucva_ (5ucv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (122 species)
    not a true protein
  7. 2285072Species Neisseria gonorrhoeae [TaxId:521006] [328373] (1 PDB entry)
  8. 2285073Domain d5ucva_: 5ucv A: [328374]
    automated match to d1puia_
    complexed with act, cl, gdp, gol, po4

Details for d5ucva_

PDB Entry: 5ucv (more details), 1.8 Å

PDB Description: crystal structure of a ribosome biogenesis gtp-binding protein (ysxc) from neisseria gonorrhoeae with bound gdp
PDB Compounds: (A:) Probable GTP-binding protein engB

SCOPe Domain Sequences for d5ucva_:

Sequence, based on SEQRES records: (download)

>d5ucva_ c.37.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
nlfqnakffttvnhlkdlpdtpleiafvgrsnagkssaintltnhvrlayvsktpgrtqh
inffelqngnfmvdlpgygyaqvpeavrahwvnllgdylrhrkqliglvlimdarhplke
ldirmldffhttgrpvhillskadklskneqiktlsqvkkllkpysdrqnisvqlfsslk
kqgideanrtvgswfdaada

Sequence, based on observed residues (ATOM records): (download)

>d5ucva_ c.37.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
nlfqnakffttvnhlkdlpdtpleiafvgrsnagkssaintltnhqhinffelqngnfmv
dlpgygyaqvpeavrahwvnllgdylrhrkqliglvlimdarhplkeldirmldffhttg
rpvhillskadklskneqiktlsqvkkllkpysdrqnisvqlfsslkkqgideanrtvgs
wfdaada

SCOPe Domain Coordinates for d5ucva_:

Click to download the PDB-style file with coordinates for d5ucva_.
(The format of our PDB-style files is described here.)

Timeline for d5ucva_:

  • d5ucva_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12