Lineage for d5ti8b_ (5ti8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (120 species)
    not a true protein
  7. 2284909Species Pseudomonas sp. [TaxId:95619] [328210] (1 PDB entry)
  8. 2285065Domain d5ti8b_: 5ti8 B: [328366]
    automated match to d4e3qa_
    complexed with ca

Details for d5ti8b_

PDB Entry: 5ti8 (more details), 2.07 Å

PDB Description: crystal structure of an aspartate aminotransferase from pseudomonas
PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d5ti8b_:

Sequence, based on SEQRES records: (download)

>d5ti8b_ c.67.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 95619]}
riitkaegvylwdsegnkildgmaglwcmnvgygrkelaevaykqmlelpyynlffqtah
ppalelakaiadiapegmnhvfftgsgsesndtvlrmvrhywsikgkpqkkvvigrwngy
hgstvagvslggmkalhsqgdlpipgivhiaqpywygeggdmsaeefgvwaaeqlekkil
evgeenvaafiaepiqgaggvivppdtywpkireilakyeilfiadevicgfgrtgewfg
sqyygnapdlmpiakgltsgyipmggvivrdeivdtlneggefyhgftysghpvaaaval
enirilreekivetvkaetapylqkrwqeladhplvgeargvgmvgalelvknkktrerf
engvgmlcrehcfrnglimravgdtmiispplvitkpeidelitlarkcldqtaaval

Sequence, based on observed residues (ATOM records): (download)

>d5ti8b_ c.67.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 95619]}
riitkaegvylwdsegnkildgmaglwcmnvgygrkelaevaykqmlelpyynlffqtah
ppalelakaiadiapegmnhvfftgsgsesndtvlrmvrhywsikgkpqkkvvigrwnpg
ivhiaqpywygeggdmsaeefgvwaaeqlekkilevgeenvaafiaepiqgaggvivppd
tywpkireilakyeilfiadevicgfgrtgewfgsqyygnapdlmpiakgltsgyipmgg
vivrdeivdtlnetysghpvaaavalenirilreekivetvkaetapylqkrwqeladhp
lvgeargvgmvgalelvknkktrerfengvgmlcrehcfrnglimravgdtmiispplvi
tkpeidelitlarkcldqtaaval

SCOPe Domain Coordinates for d5ti8b_:

Click to download the PDB-style file with coordinates for d5ti8b_.
(The format of our PDB-style files is described here.)

Timeline for d5ti8b_:

  • d5ti8b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12