Lineage for d5ub8a_ (5ub8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (127 species)
    not a true protein
  7. 2285060Species Candida albicans [TaxId:237561] [328361] (2 PDB entries)
  8. 2285061Domain d5ub8a_: 5ub8 A: [328362]
    automated match to d1ukvy_
    complexed with gdp, zn

Details for d5ub8a_

PDB Entry: 5ub8 (more details), 2.35 Å

PDB Description: crystal structure of ypt31, a rab family gtpase from candida albicans, in complex with gdp and zn(ii)
PDB Compounds: (A:) Likely rab family GTP-binding protein

SCOPe Domain Sequences for d5ub8a_:

Sequence, based on SEQRES records: (download)

>d5ub8a_ c.37.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
ysydyeylykivligdsgvgksnllsrftrdefnlesrstigvefatrtleidgkrvkaq
iwdtagqeryraitsayyrgavgalivydiaktesyesvsrwlkelkehadaniiielvg
nksdldhlravpteeaknfamennllfteasalssdnvdlsfhqllkniyemiskhqle

Sequence, based on observed residues (ATOM records): (download)

>d5ub8a_ c.37.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
ysydyeylykivligdsgvgksnllsrftrdefnlegvefatrtleidgkrvkaqiwdta
gqeryraitsayyrgavgalivydiaktesyesvsrwlkelkehadaniiielvgnksdl
dhlravpteeaknfamennllfteasalssdnvdlsfhqllkniyemiskhqle

SCOPe Domain Coordinates for d5ub8a_:

Click to download the PDB-style file with coordinates for d5ub8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ub8a_:

  • d5ub8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12