SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ub8a_ (5ub8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (125 species)
    not a true protein
  7. 2285060Species Candida albicans [TaxId:237561] [328361] (1 PDB entry)
  8. 2285061Domain d5ub8a_: 5ub8 A: [328362]
    automated match to d1ukvy_
    complexed with gdp, zn

Details for d5ub8a_

PDB Entry: 5ub8 (more details), 2.35 Å

PDB Description: crystal structure of ypt31, a rab family gtpase from candida albicans, in complex with gdp and zn(ii)
PDB Compounds: (A:) Likely rab family GTP-binding protein

SCOPe Domain Sequences for d5ub8a_:

Sequence, based on SEQRES records: (download)

>d5ub8a_ c.37.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
ysydyeylykivligdsgvgksnllsrftrdefnlesrstigvefatrtleidgkrvkaq
iwdtagqeryraitsayyrgavgalivydiaktesyesvsrwlkelkehadaniiielvg
nksdldhlravpteeaknfamennllfteasalssdnvdlsfhqllkniyemiskhqle

Sequence, based on observed residues (ATOM records): (download)

>d5ub8a_ c.37.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
ysydyeylykivligdsgvgksnllsrftrdefnlegvefatrtleidgkrvkaqiwdta
gqeryraitsayyrgavgalivydiaktesyesvsrwlkelkehadaniiielvgnksdl
dhlravpteeaknfamennllfteasalssdnvdlsfhqllkniyemiskhqle

SCOPe Domain Coordinates for d5ub8a_:

Click to download the PDB-style file with coordinates for d5ub8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ub8a_:

  • d5ub8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12