Lineage for d2gssb2 (2gss B:2-76)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396206Protein Class pi GST [81358] (3 species)
  7. 396207Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 396238Domain d2gssb2: 2gss B:2-76 [32835]
    Other proteins in same PDB: d2gssa1, d2gssb1
    complexed with eaa, mes, so4

Details for d2gssb2

PDB Entry: 2gss (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1 in complex with ethacrynic acid

SCOP Domain Sequences for d2gssb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gssb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens)}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d2gssb2:

Click to download the PDB-style file with coordinates for d2gssb2.
(The format of our PDB-style files is described here.)

Timeline for d2gssb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gssb1