Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.357: NosL/MerB-like [160386] (1 superfamily) unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication |
Superfamily d.357.1: NosL/MerB-like [160387] (2 families) |
Family d.357.1.2: MerB-like [160391] (1 protein) Pfam PF03243 |
Protein Alkylmercury lyase MerB [160392] (1 species) |
Species Escherichia coli [TaxId:562] [160393] (17 PDB entries) Uniprot P77072 81-212 |
Domain d5u88b2: 5u88 B:81-208 [328347] Other proteins in same PDB: d5u88a1, d5u88b1 automated match to d1s6la2 complexed with act, zn9 |
PDB Entry: 5u88 (more details), 1.8 Å
SCOPe Domain Sequences for d5u88b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u88b2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn rhllqtms
Timeline for d5u88b2: