Lineage for d5u88b1 (5u88 B:1-80)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983613Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)
  6. 1983614Protein Alkylmercury lyase MerB [158324] (1 species)
  7. 1983615Species Escherichia coli [TaxId:562] [158325] (17 PDB entries)
    Uniprot P77072 21-80
  8. 2285045Domain d5u88b1: 5u88 B:1-80 [328346]
    Other proteins in same PDB: d5u88a2, d5u88b2
    automated match to d1s6la1
    complexed with act, zn9

Details for d5u88b1

PDB Entry: 5u88 (more details), 1.8 Å

PDB Description: crystal structure of a merb-triimethyllead complex.
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d5u88b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u88b1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

SCOPe Domain Coordinates for d5u88b1:

Click to download the PDB-style file with coordinates for d5u88b1.
(The format of our PDB-style files is described here.)

Timeline for d5u88b1:

  • d5u88b1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5u88b2