Lineage for d5u20c1 (5u20 C:1-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132376Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)
  8. 2285024Domain d5u20c1: 5u20 C:1-360 [328325]
    Other proteins in same PDB: d5u20a2, d5u20b2, d5u20c2, d5u20d2
    automated match to d2ogea_
    complexed with cl, edo, na

Details for d5u20c1

PDB Entry: 5u20 (more details), 1.5 Å

PDB Description: x-ray structure of the wlarg aminotransferase from campylobacter jejuni, internal plp-aldimine
PDB Compounds: (C:) Putative aminotransferase

SCOPe Domain Sequences for d5u20c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u20c1 c.67.1.0 (C:1-360) automated matches {Campylobacter jejuni [TaxId: 197]}
mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
ypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv

SCOPe Domain Coordinates for d5u20c1:

Click to download the PDB-style file with coordinates for d5u20c1.
(The format of our PDB-style files is described here.)

Timeline for d5u20c1:

  • d5u20c1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12