Lineage for d3gssa2 (3gss A:2-76)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181085Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)
  8. 181117Domain d3gssa2: 3gss A:2-76 [32832]
    Other proteins in same PDB: d3gssa1, d3gssb1

Details for d3gssa2

PDB Entry: 3gss (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1 in complex with ethacrynic acid-glutathione conjugate

SCOP Domain Sequences for d3gssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gssa2 c.47.1.5 (A:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d3gssa2:

Click to download the PDB-style file with coordinates for d3gssa2.
(The format of our PDB-style files is described here.)

Timeline for d3gssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gssa1