SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u7cb1 (5u7c B:1-80)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983613Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)
  6. 1983614Protein Alkylmercury lyase MerB [158324] (1 species)
  7. 1983615Species Escherichia coli [TaxId:562] [158325] (17 PDB entries)
    Uniprot P77072 21-80
  8. 2285004Domain d5u7cb1: 5u7c B:1-80 [328305]
    Other proteins in same PDB: d5u7ca2, d5u7cb2
    automated match to d1s6la1
    complexed with act, br, zn7

Details for d5u7cb1

PDB Entry: 5u7c (more details), 1.75 Å

PDB Description: crystal structure of the lead-bound form of merb formed from diethyllead.
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d5u7cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u7cb1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

SCOPe Domain Coordinates for d5u7cb1:

Click to download the PDB-style file with coordinates for d5u7cb1.
(The format of our PDB-style files is described here.)

Timeline for d5u7cb1:

  • d5u7cb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5u7cb2