Lineage for d5trrp_ (5trr P:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2204923Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries)
  8. 2285000Domain d5trrp_: 5trr P: [328301]
    automated match to d2fhh1_
    complexed with 7hy

Details for d5trrp_

PDB Entry: 5trr (more details), 3.1 Å

PDB Description: structure of mycobacterium tuberculosis proteasome in complex with n, c-capped dipeptide pks2169
PDB Compounds: (P:) Proteasome subunit alpha

SCOPe Domain Sequences for d5trrp_:

Sequence, based on SEQRES records: (download)

>d5trrp_ d.153.1.4 (P:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvd

Sequence, based on observed residues (ATOM records): (download)

>d5trrp_ d.153.1.4 (P:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragstlgvaslevavldanrprrafrritgsalqallvd

SCOPe Domain Coordinates for d5trrp_:

Click to download the PDB-style file with coordinates for d5trrp_.
(The format of our PDB-style files is described here.)

Timeline for d5trrp_:

  • d5trrp_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12