SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u23a1 (5u23 A:1-360)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (110 species)
    not a true protein
  7. 2132376Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)
  8. 2284991Domain d5u23a1: 5u23 A:1-360 [328292]
    Other proteins in same PDB: d5u23a2, d5u23c2
    automated match to d2ogea_
    complexed with cl, edo, mpo, na, tqp

Details for d5u23a1

PDB Entry: 5u23 (more details), 1.45 Å

PDB Description: x-ray structure of the wlarg aminotransferase from campylobacter jejuni in complex with tdp-qui3n
PDB Compounds: (A:) Putative aminotransferase

SCOPe Domain Sequences for d5u23a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u23a1 c.67.1.0 (A:1-360) automated matches {Campylobacter jejuni [TaxId: 197]}
mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
ypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv

SCOPe Domain Coordinates for d5u23a1:

Click to download the PDB-style file with coordinates for d5u23a1.
(The format of our PDB-style files is described here.)

Timeline for d5u23a1:

  • d5u23a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5u23a2