SCOPe 2.06: Domain d5u21d1: 5u21 D:1-360

Lineage for d5u21d1 (5u21 D:1-360)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries)

8. Domain d5u21d1: 5u21 D:1-360 [328283]
   Other proteins in same PDB: d5u21a2, d5u21b2, d5u21c2, d5u21d2
   automated match to d2ogeb_
   complexed with cl, edo, na, tqp; mutant

Details for d5u21d1

PDB Entry: 5u21, 1.6 Å

PDB Description: x-ray structure of the wlarf aminotransferase from campylobacter jejuni, k184a mutant in complex with tdp-qui3n

PDB Compounds: (D:) Putative aminotransferase

SCOPe Domain Sequences for d5u21d1:

Sequence; same for both SEQRES and ATOM records:

>d5u21d1 c.67.1.0 (D:1-360) automated matches {Campylobacter jejuni [TaxId: 197]}
mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
ypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv

Timeline for d5u21d1:

• d5u21d1 is new in SCOPe 2.06-stable
  
• d5u21d1 appears in SCOPe 2.07
  
• d5u21d1 appears in the current release, SCOPe 2.08