Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) Pfam PF16454 |
Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) |
Protein automated matches [310859] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [311310] (4 PDB entries) |
Domain d5t8fb_: 5t8f B: [328281] automated match to d5dxub_ complexed with 799 |
PDB Entry: 5t8f (more details), 2.91 Å
SCOPe Domain Sequences for d5t8fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t8fb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg
Timeline for d5t8fb_: