SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t8fb_ (5t8f B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2239862Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2240026Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 2240027Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 protein domains)
  6. 2240031Protein automated matches [310859] (2 species)
    not a true protein
  7. 2240032Species Cow (Bos taurus) [TaxId:9913] [311310] (4 PDB entries)
  8. 2284980Domain d5t8fb_: 5t8f B: [328281]
    automated match to d5dxub_
    complexed with 799

Details for d5t8fb_

PDB Entry: 5t8f (more details), 2.91 Å

PDB Description: p110delta/p85alpha with taselisib (gdc-0032)
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d5t8fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8fb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

SCOPe Domain Coordinates for d5t8fb_:

Click to download the PDB-style file with coordinates for d5t8fb_.
(The format of our PDB-style files is described here.)

Timeline for d5t8fb_:

  • d5t8fb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12