Lineage for d5tg5a_ (5tg5 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218833Species Acinetobacter baumannii [TaxId:470] [194613] (39 PDB entries)
  8. 2284946Domain d5tg5a_: 5tg5 A: [328247]
    automated match to d4f94a_
    complexed with bct, jw8, mee, so4

Details for d5tg5a_

PDB Entry: 5tg5 (more details), 1.75 Å

PDB Description: oxa-24/40 in complex with boronic acid ba8
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5tg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tg5a_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
mhissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnali
glenhkattneifkwdgkkrtypawekdmtlgeamalsavpvyqelarrtglelmqkevk
rvnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikev
ngskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneityksle
nlgii

SCOPe Domain Coordinates for d5tg5a_:

Click to download the PDB-style file with coordinates for d5tg5a_.
(The format of our PDB-style files is described here.)

Timeline for d5tg5a_:

  • d5tg5a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12