SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tjrd_ (5tjr D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (42 species)
    not a true protein
  7. 2284940Species Pseudomonas sp. [TaxId:1502784] [328241] (1 PDB entry)
  8. 2284941Domain d5tjrd_: 5tjr D: [328242]
    automated match to d4iyma_
    complexed with adp

Details for d5tjrd_

PDB Entry: 5tjr (more details), 2.95 Å

PDB Description: x-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. aac
PDB Compounds: (D:) Methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d5tjrd_:

Sequence, based on SEQRES records: (download)

>d5tjrd_ c.82.1.0 (D:) automated matches {Pseudomonas sp. [TaxId: 1502784]}
tlikhliggeliadtgrtadvfnpstgeavrkvpladretmqqaidaakaafpawrntpp
akraqvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkge
ysrnvgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsst
lliaelfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgk
rvqalggaknhavlmpdadldnavsalmgaaygscgercmaisvavcvgdqiadalvqkl
vpqikglkigagtscgldmgplvtgaardkvtgyidtgvaqgaelvvdgrgykvagheng
fflggtlfdrvtpemtiykeeifgpvlcivrvnsleeamqlindheygngtciftrdgea
arlfcdeievgmvgvnvplpvpvayhsfggwkrslfgdlhaygpdgvrfytkrkaitqrw
pqrksheaaqfaf

Sequence, based on observed residues (ATOM records): (download)

>d5tjrd_ c.82.1.0 (D:) automated matches {Pseudomonas sp. [TaxId: 1502784]}
tlikhliggeliadtgrtadvfnpstrkvpladretmqqaidaakaafpawrntppakra
qvlfrfkqlleaneerivkliseehgktiedaagelkrgienveyataapeilkgeysrn
vgpnidawsdfqpigvvagitpfnfpamvplwmyplaiacgntfilkpserdpsstllia
elfheaglpkgvlnvvhgdkgavdalieapevkalsfvgstpiaeyiysegtkrgkrvqa
lggaknhavlmpdadldnavsalmgaaygcmaisvavcvgdqiadalvqklvpqikglkg
aardkvtgyidtgvaqgaelvvdgrgykvaghengfflggtlfdrvtpemtiykeeifgp
vlcivrvnsleeamqlindheygngtciftrdgeaarlfcdeievgmvgvnvplpvpvay
hsfggwkrslfgdlhaygpdgvrfytkrkaitqrwpqrksheaaqfaf

SCOPe Domain Coordinates for d5tjrd_:

Click to download the PDB-style file with coordinates for d5tjrd_.
(The format of our PDB-style files is described here.)

Timeline for d5tjrd_:

  • d5tjrd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12