SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t2za_ (5t2z A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2060049Protein automated matches [190433] (11 species)
    not a true protein
  7. 2060093Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (24 PDB entries)
  8. 2284933Domain d5t2za_: 5t2z A: [328234]
    automated match to d4njsa_
    complexed with 017

Details for d5t2za_

PDB Entry: 5t2z (more details), 1.5 Å

PDB Description: crystal structure of multi-drug resistant hiv-1 protease pr-s17 in complex with darunavir
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5t2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2za_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikiggqlrealldtgaddtvledidlpgrwkpklivgiggfvkvrqye
qvpieiaghkvvgtvligptpsniigrnlmtqlgatlnf

SCOPe Domain Coordinates for d5t2za_:

Click to download the PDB-style file with coordinates for d5t2za_.
(The format of our PDB-style files is described here.)

Timeline for d5t2za_:

  • d5t2za_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12