SCOPe 2.08: Domain d5jcta_: 5jct A:

Lineage for d5jcta_ (5jct A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.12: Pirin-like [101984] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Pirin [101985] (1 species)
   Bcl-3 and nuclear factor I-interacting protein

7. Species Human (Homo sapiens) [TaxId:9606] [101986] (13 PDB entries)

8. Domain d5jcta_: 5jct A: [328222]
   automated match to d4ewea_
   complexed with 6jq, dms, fe, gol

Details for d5jcta_

PDB Entry: 5jct, 1.73 Å

PDB Description: crystal structure of human pirin in complex with a chemical probe pyrrolidine 24

PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d5jcta_:

Sequence; same for both SEQRES and ATOM records:

>d5jcta_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}
skkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfet
vsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrss
ekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakhs
qpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvliag
eplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

Timeline for d5jcta_:

• d5jcta_ first appeared in SCOPe 2.06
  
• d5jcta_ appears in SCOPe 2.07