SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jcta_ (5jct A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070401Family b.82.1.12: Pirin-like [101984] (3 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2070414Protein automated matches [191170] (1 species)
    not a true protein
  7. 2070415Species Human (Homo sapiens) [TaxId:9606] [189408] (2 PDB entries)
  8. 2284921Domain d5jcta_: 5jct A: [328222]
    automated match to d4ewea_
    complexed with 6jq, dms, fe, gol

Details for d5jcta_

PDB Entry: 5jct (more details), 1.73 Å

PDB Description: crystal structure of human pirin in complex with a chemical probe pyrrolidine 24
PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d5jcta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcta_ b.82.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfet
vsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrss
ekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakhs
qpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvliag
eplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

SCOPe Domain Coordinates for d5jcta_:

Click to download the PDB-style file with coordinates for d5jcta_.
(The format of our PDB-style files is described here.)

Timeline for d5jcta_:

  • d5jcta_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12