Lineage for d5jcta_ (5jct A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070401Family b.82.1.12: Pirin-like [101984] (3 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2070414Protein automated matches [191170] (1 species)
    not a true protein
  7. 2070415Species Human (Homo sapiens) [TaxId:9606] [189408] (2 PDB entries)
  8. 2284921Domain d5jcta_: 5jct A: [328222]
    automated match to d4ewea_
    complexed with 6jq, dms, fe, gol

Details for d5jcta_

PDB Entry: 5jct (more details), 1.73 Å

PDB Description: crystal structure of human pirin in complex with a chemical probe pyrrolidine 24
PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d5jcta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcta_ b.82.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfet
vsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrss
ekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakhs
qpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvliag
eplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

SCOPe Domain Coordinates for d5jcta_:

Click to download the PDB-style file with coordinates for d5jcta_.
(The format of our PDB-style files is described here.)

Timeline for d5jcta_:

  • d5jcta_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12