SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ti8a_ (5ti8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (111 species)
    not a true protein
  7. 2284909Species Pseudomonas sp. [TaxId:95619] [328210] (1 PDB entry)
  8. 2284910Domain d5ti8a_: 5ti8 A: [328211]
    automated match to d4e3qa_
    complexed with ca

Details for d5ti8a_

PDB Entry: 5ti8 (more details), 2.07 Å

PDB Description: crystal structure of an aspartate aminotransferase from pseudomonas
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d5ti8a_:

Sequence, based on SEQRES records: (download)

>d5ti8a_ c.67.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 95619]}
riitkaegvylwdsegnkildgmaglwcmnvgygrkelaevaykqmlelpyynlffqtah
ppalelakaiadiapegmnhvfftgsgsesndtvlrmvrhywsikgkpqkkvvigrwngy
hgstvagvslggmkalhsqgdlpipgivhiaqpywygeggdmsaeefgvwaaeqlekkil
evgeenvaafiaepiqgaggvivppdtywpkireilakyeilfiadevicgfgrtgewfg
sqyygnapdlmpiakgltsgyipmggvivrdeivdtlneggefyhgftysghpvaaaval
enirilreekivetvkaetapylqkrwqeladhplvgeargvgmvgalelvknkktrerf
engvgmlcrehcfrnglimravgdtmiispplvitkpeidelitlarkcldqtaaval

Sequence, based on observed residues (ATOM records): (download)

>d5ti8a_ c.67.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 95619]}
riitkaegvylwdsegnkildgmaglwcmnvgygrkelaevaykqmlelpyynlffqtah
ppalelakaiadiapegmnhvfftgsgsesndtvlrmvrhywsikgkpqkkvvigrwngp
ipgivhiaqpywygeggdmsaeefgvwaaeqlekkilevgeenvaafiaepiqgaggviv
ppdtywpkireilakyeilfiadevicgfgrtgewfgsqyygnapdlmpiakgltsgyip
mggvivrdeivdtlnetysghpvaaavalenirilreekivetvkaetapylqkrwqela
dhplvgeargvgmvgalelvknkktrerfengvgmlcrehcfrnglimravgdtmiispp
lvitkpeidelitlarkcldqtaaval

SCOPe Domain Coordinates for d5ti8a_:

Click to download the PDB-style file with coordinates for d5ti8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ti8a_:

  • d5ti8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12