Lineage for d5trgj_ (5trg J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (14 species)
    not a true protein
  7. 2554266Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries)
  8. 2554530Domain d5trgj_: 5trg J: [328206]
    automated match to d3krdr_
    complexed with 7hj

Details for d5trgj_

PDB Entry: 5trg (more details), 2.8 Å

PDB Description: structure of mycobacterium tuberculosis proteasome in complex with n, c-capped dipeptide dplg-2
PDB Compounds: (J:) Proteasome subunit beta

SCOPe Domain Sequences for d5trgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trgj_ d.153.1.4 (J:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d5trgj_:

Click to download the PDB-style file with coordinates for d5trgj_.
(The format of our PDB-style files is described here.)

Timeline for d5trgj_: