Lineage for d5thoy_ (5tho Y:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995626Species Mycobacterium tuberculosis [TaxId:419947] [328158] (1 PDB entry)
  8. 2995651Domain d5thoy_: 5tho Y: [328205]
    automated match to d3krdr_
    complexed with 7c7

Details for d5thoy_

PDB Entry: 5tho (more details), 3 Å

PDB Description: crystal structure of mycobacterium tuberculosis proteasome in complex with n,c-capped dipeptide inhibitor pks2205
PDB Compounds: (Y:) Proteasome subunit beta

SCOPe Domain Sequences for d5thoy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thoy_ d.153.1.4 (Y:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg

SCOPe Domain Coordinates for d5thoy_:

Click to download the PDB-style file with coordinates for d5thoy_.
(The format of our PDB-style files is described here.)

Timeline for d5thoy_: