SCOP 1.55: Domain d2pgta2: 2pgt A:0-76

Lineage for d2pgta2 (2pgt A:0-76)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)

8. Domain d2pgta2: 2pgt A:0-76 [32820]
   Other proteins in same PDB: d2pgta1, d2pgtb1

Details for d2pgta2

PDB Entry: 2pgt, 1.9 Å

PDB Description: crystal structure of human glutathione s-transferase p1-1[v104] complexed with (9r,10r)-9-(s-glutathionyl)-10-hydroxy-9,10-dihydrophenanthrene

SCOP Domain Sequences for d2pgta2:

Sequence; same for both SEQRES and ATOM records:

>d2pgta2 c.47.1.5 (A:0-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

Timeline for d2pgta2:

• d2pgta2 appears in SCOP 1.57
  
• d2pgta2 appears in the current release, SCOPe 2.08