SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hgea1 (5hge A:4-238)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (17 species)
    not a true protein
  7. 2165183Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (47 PDB entries)
  8. 2284884Domain d5hgea1: 5hge A:4-238 [328185]
    Other proteins in same PDB: d5hgea2
    automated match to d3st3a_
    complexed with mpd

Details for d5hgea1

PDB Entry: 5hge (more details), 1.86 Å

PDB Description: filamentous assembly of green fluorescent protein supported by a c- terminal fusion of 18-residues, viewed in space group p212121
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5hgea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hgea1 d.22.1.1 (A:4-238) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnriel
kgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyqqn
tpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

SCOPe Domain Coordinates for d5hgea1:

Click to download the PDB-style file with coordinates for d5hgea1.
(The format of our PDB-style files is described here.)

Timeline for d5hgea1:

  • d5hgea1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12

View in 3D
Domains from same chain:
(mouse over for more information)
d5hgea2