Lineage for d17gsa2 (17gs A:0-76)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123401Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)
  8. 123408Domain d17gsa2: 17gs A:0-76 [32818]
    Other proteins in same PDB: d17gsa1, d17gsb1

Details for d17gsa2

PDB Entry: 17gs (more details), 1.9 Å

PDB Description: glutathione s-transferase p1-1

SCOP Domain Sequences for d17gsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d17gsa2 c.47.1.5 (A:0-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgd
ltlyqsntilrhlgrtl

SCOP Domain Coordinates for d17gsa2:

Click to download the PDB-style file with coordinates for d17gsa2.
(The format of our PDB-style files is described here.)

Timeline for d17gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d17gsa1