Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:419947] [328158] (1 PDB entry) |
Domain d5thof_: 5tho F: [328171] automated match to d2fhh1_ complexed with 7c7 |
PDB Entry: 5tho (more details), 3 Å
SCOPe Domain Sequences for d5thof_:
Sequence, based on SEQRES records: (download)
>d5thof_ d.153.1.4 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallv
>d5thof_ d.153.1.4 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal ragslgvaslevavldanrprrafrritgsalqallv
Timeline for d5thof_: