Lineage for d5lqff_ (5lqf F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967083Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2967084Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2967085Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2967112Protein automated matches [227065] (3 species)
    not a true protein
  7. 2967121Species Human (Homo sapiens) [TaxId:9606] [273041] (10 PDB entries)
  8. 2967124Domain d5lqff_: 5lqf F: [328170]
    Other proteins in same PDB: d5lqfa1, d5lqfa2, d5lqfd1, d5lqfd2
    automated match to d1cksb_
    complexed with 4sp

Details for d5lqff_

PDB Entry: 5lqf (more details), 2.06 Å

PDB Description: cdk1/cyclinb1/cks2 in complex with nu6102
PDB Compounds: (F:) Cyclin-dependent kinases regulatory subunit 2

SCOPe Domain Sequences for d5lqff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqff_ d.97.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih
epephillfrrplp

SCOPe Domain Coordinates for d5lqff_:

Click to download the PDB-style file with coordinates for d5lqff_.
(The format of our PDB-style files is described here.)

Timeline for d5lqff_: