SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lqff_ (5lqf F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186443Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2186444Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2186445Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 protein domains)
  6. 2186472Protein automated matches [227065] (3 species)
    not a true protein
  7. 2186481Species Human (Homo sapiens) [TaxId:9606] [273041] (5 PDB entries)
  8. 2284869Domain d5lqff_: 5lqf F: [328170]
    Other proteins in same PDB: d5lqfa1, d5lqfa2, d5lqfd1, d5lqfd2
    automated match to d1cksb_
    complexed with 4sp

Details for d5lqff_

PDB Entry: 5lqf (more details), 2.06 Å

PDB Description: cdk1/cyclinb1/cks2 in complex with nu6102
PDB Compounds: (F:) Cyclin-dependent kinases regulatory subunit 2

SCOPe Domain Sequences for d5lqff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqff_ d.97.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymih
epephillfrrplp

SCOPe Domain Coordinates for d5lqff_:

Click to download the PDB-style file with coordinates for d5lqff_.
(The format of our PDB-style files is described here.)

Timeline for d5lqff_:

  • d5lqff_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12