Lineage for d5mccb_ (5mcc B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2268332Species Daphnia pulex [TaxId:6669] [311638] (12 PDB entries)
  8. 2284868Domain d5mccb_: 5mcc B: [328169]
    automated match to d4xnnb_
    complexed with gol, so4

Details for d5mccb_

PDB Entry: 5mcc (more details), 2 Å

PDB Description: radiation damage to gh7 family cellobiohydrolase from daphnia pulex: dose (dwd) 1.11 mgy
PDB Compounds: (B:) Cellobiohydrolase CHBI

SCOPe Domain Sequences for d5mccb_:

Sequence, based on SEQRES records: (download)

>d5mccb_ b.29.1.0 (B:) automated matches {Daphnia pulex [TaxId: 6669]}
envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
evevtqanavvsfgnikfgpigstv

Sequence, based on observed residues (ATOM records): (download)

>d5mccb_ b.29.1.0 (B:) automated matches {Daphnia pulex [TaxId: 6669]}
envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvtnigartflldstktryrm
fqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaqcphd
vkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndqtrce
gvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfittdg
tdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhknkggm
kqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvpsevev
tqanavvsfgnikfgpigstv

SCOPe Domain Coordinates for d5mccb_:

Click to download the PDB-style file with coordinates for d5mccb_.
(The format of our PDB-style files is described here.)

Timeline for d5mccb_:

  • d5mccb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12