SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thom_ (5tho M:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2201309Family d.153.1.4: Proteasome subunits [56251] (4 protein domains)
  6. 2203920Protein automated matches [190144] (11 species)
    not a true protein
  7. 2284857Species Mycobacterium tuberculosis [TaxId:419947] [328158] (1 PDB entry)
  8. 2284865Domain d5thom_: 5tho M: [328166]
    automated match to d3krdr_
    complexed with 7c7

Details for d5thom_

PDB Entry: 5tho (more details), 3 Å

PDB Description: crystal structure of mycobacterium tuberculosis proteasome in complex with n,c-capped dipeptide inhibitor pks2205
PDB Compounds: (M:) Proteasome subunit beta

SCOPe Domain Sequences for d5thom_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thom_ d.153.1.4 (M:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg

SCOPe Domain Coordinates for d5thom_:

Click to download the PDB-style file with coordinates for d5thom_.
(The format of our PDB-style files is described here.)

Timeline for d5thom_:

  • d5thom_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12